PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00615.1_g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 266aa    MW: 29987.8 Da    PI: 7.6619
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00615.1_g00011.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.8e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd llvd+++++G g+W++ +r  g+ R++k+c++rw +yl
  Rsa1.0_00615.1_g00011.1 14 KGAWTKEEDHLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNYL 61
                             79********************************************97 PP

2Myb_DNA-binding56.18.5e-1867111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg++T+eEdel+++++ +lG++ W++Ia ++  gRt++++k++w+++
  Rsa1.0_00615.1_g00011.1  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLA-GRTDNEIKNYWNTH 111
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.601961IPR017930Myb domain
SuperFamilySSF466892.91E-3012108IPR009057Homeodomain-like
SMARTSM007171.0E-121363IPR001005SANT/Myb domain
PfamPF002493.4E-161461IPR001005SANT/Myb domain
CDDcd001672.76E-101661No hitNo description
PROSITE profilePS5129428.61862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2865117IPR009057Homeodomain-like
SMARTSM007173.1E-1766114IPR001005SANT/Myb domain
PfamPF002496.4E-1667111IPR001005SANT/Myb domain
CDDcd001675.67E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGRSPCCEKA HMNKGAWTKE EDHLLVDYIR KHGEGCWRSL PRAAGLQRCG KSCRLRWMNY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLAGRT DNEIKNYWNT HIKRKLVSRG  120
IDPNTHRPIN VIPPSKTTTP SLVNDEPVQF DLAGPDQHQT VKPEPMALDR EEVNNDINNN  180
NSTSSGTTSD DDCVLNLELS VGPATTRYQS TRKANLDSVE STGRWGSELF GAQAEVCLCC  240
RIGFHNESCP SCRVSDARTI WESKIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
1h8a_C5e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667360.0KC966736.1 Brassica napus MYB transcription factor 3 (MYB3.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009115618.11e-177PREDICTED: transcription factor MYB3
SwissprotQ9S9K91e-129MYB3_ARATH; Transcription factor MYB3
TrEMBLA0A078EYR21e-177A0A078EYR2_BRANA; BnaC05g17910D protein
STRINGBra024526.1-P1e-176(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-125myb domain protein 3